More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| caspase 2, apoptosis-related cysteine peptidase | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human CASP2(378-409aa RNTKRGSWYIEALAQVFSERACDMHVADMLVK), different from the related mouse and rat sequences by one amino acid. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | CASP2 |
Protein | Caspase-2 |
Uniprot ID | P42575 |
Function | Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival. |
Tissue Specificity | Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle. |
Sub-cellular localization | |
Sequence Similarities | Belongs to the peptidase C14A family. |
Aliases | CASP 2 antibody|CASP-2 antibody|Casp2 antibody|CASP2_HUMAN antibody| Caspase 2 antibody|Caspase 2 apoptosis related cysteine peptidase antibody| Caspase-2 subunit p12 antibody|Caspase2 antibody|ICH 1 antibody|ICH 1 protease antibody|ICH 1L antibody|ICH1 antibody|ICH1 protease antibody|ICH1L antibody|NEDD-2 antibody|NEDD2 antibody|Neural precursor cell expressed developmentally down-regulated protein 2 antibody|PPP1R57 antibody|Protease ICH-1 antibody|Protein phosphatase 1 regulatory subunit 57 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- Caspase-2 antibody, ASA-B0290, Western blotting
All lanes: Anti Caspase-2 (ASA-B0290) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: A549 Whole Cell Lysate at 40ug
Lane 4: PANC Whole Cell Lysate at 40ug
Lane 5: 293T Whole Cell Lysate at 40ug
Predicted bind size: 18KD
Observed bind size: 18KD
All lanes: Anti Caspase-2 (ASA-B0290) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: A549 Whole Cell Lysate at 40ug
Lane 4: PANC Whole Cell Lysate at 40ug
Lane 5: 293T Whole Cell Lysate at 40ug
Predicted bind size: 18KD
Observed bind size: 18KD
