Bmi1  Antibody View larger

Bmi1 Antibody

ASA-B0233

$386.90

More info

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

BMI1 proto-oncogene, polycomb ring finger Polyclonal IgG Rabbit Human, Mouse, Rat WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

BMI1

Protein

Polycomb complex protein BMI-1

Uniprot ID

P35226

Function

Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.

Tissue Specificity

Sub-cellular localization

Nucleus. Cytoplasm.

Sequence Similarities

Contains 1 RING-type zinc finger.

Aliases

B lymphoma Mo MLV insertion region (mouse) antibody|B lymphoma Mo MLV insertion region 1 homolog antibody|Bmi 1 antibody|BMI1 antibody|BMI1 polycomb ring finger oncogene antibody|BMI1_HUMAN antibody|Flvi 2/bmi 1 antibody|FLVI2/BMI1 antibody|MGC12685 antibody|Murine leukemia viral (bmi 1) oncogene homolog antibody|Oncogene BMI 1 antibody|PCGF 4 antibody|PCGF4 antibody|Polycomb complex protein BMI 1 antibody|Polycomb complex protein BMI-1 antibody|Polycomb group protein Bmi1 antibody|Polycomb group ring finger 4 antibody|Polycomb group RING finger protein 4 antibody|RING finger protein 51 antibody|RNF 51 antibody|RNF51 antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Mouse, RatAssaySolutio's ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti-Bmi1 antibody, ASA-B0233--1.jpg
All lanes: Anti BMI1 (ASA-B0233) at 0.5ug/ml
WB: Recombinant Human BMI1 Protein 0.5ng
Predicted bind size: 37KD
Observed bind size: 37KD
Anti-Bmi1 antibody, ASA-B0233--2.jpg
All lanes: Anti BMI1 (ASA-B0233) at 0.5ug/ml
Lane 1: Rat Spleen Tissue Lysate at 50ug
Lane 2: HT1080 Whole Cell Lysate at 40ug
Lane 3: HELA Whole Cell Lysate at 40ug
Predicted bind size: 37KD
Observed bind size: 37KD

© 2024 Novateinbio.com