APRIL  Antibody View larger

APRIL Antibody

ASA-B0130

$386.90

More info

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

tumor necrosis factor (ligand) superfamily, member 13PolyclonalIgGRabbitHumanELISA, WBImmunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

TNFSF13

Protein

Tumor necrosis factor ligand superfamily member 13

Uniprot ID

O75888

Function

Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. Plays a role in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes.

Tissue Specificity

Expressed at high levels in transformed cell lines, cancers of colon, thyroid, lymphoid tissues and specifically expressed in monocytes and macrophages.

Sub-cellular localization

Secreted.

Sequence Similarities

 

Aliases

A proliferation inducing ligand antibody|A proliferation-inducing ligand antibody|APRIL antibody|CD 256 antibody|CD256 antibody|CD256 antigen antibody|Ligand antibody|PRO715 antibody|Proliferation inducing ligand APRIL antibody|TALL 2 antibody|TALL-2 antibody|TALL2 antibody|TNF and APOL related leukocyte expressed ligand 2 antibody|TNF related death ligand 1 antibody|TNF related death ligand antibody|TNF- and APOL-related leukocyte expressed ligand 2 antibody|TNF-related death ligand 1 antibody| TNF13_ HUMAN antibody|TNFSF 13 antibody|TNFSF13 antibody|TNFSF13 protein antibody|TRDL 1 antibody|TRDL-1 antibody|TRDL1 antibody|Tumor necrosis factor (ligand) superfamily member 13 antibody|Tumor necrosis factor (ligand) superfamily, member 13 antibody|Tumor necrosis factor ligand superfamily member 13 antibody|Tumor necrosis factor like protein ZTNF2 antibody|Tumor necrosis factor related death ligand antibody|Tumor necrosis factor related death ligand 1 antibody|Tumor necrosis factor superfamily member 13 antibody|TWE PRIL antibody|UNQ383 antibody| UNQ383/ PRO715 antibody| ZTNF 2 antibody|ZTNF2 antibody

Application Details

ApplicationConcentration*SpeciesValidated Using**
Western blot0.1-0.5μg/mlHumanAssaySolutio's ECL kit
ELISA0.1-0.5μg/mlHumanSandwich ELISA format


AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

Anti-APRIL
Anti-APRIL antibody, ASA-B0130, Western blotting
All lanes: Anti APRIL (ASA-B0130) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: COLO320 Whole Cell Lysate at 40ug
Lane 3: SW620 Whole Cell Lysate at 40ug
Lane 4: JURKAT Whole Cell Lysate at 40ug
Lane 5: RAJI Whole Cell Lysate at 40ug
Lane 6: U937 Whole Cell Lysate at 40ug
Predicted band size: 27KD
Observed band size: 27KD
 
 
 
 
 
 
 

© 2024 Novateinbio.com