More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| tumor necrosis factor (ligand) superfamily, member 13 | Polyclonal | IgG | Rabbit | Human | ELISA, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | TNFSF13 |
Protein | Tumor necrosis factor ligand superfamily member 13 |
Uniprot ID | O75888 |
Function | Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. Plays a role in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes. |
Tissue Specificity | Expressed at high levels in transformed cell lines, cancers of colon, thyroid, lymphoid tissues and specifically expressed in monocytes and macrophages. |
Sub-cellular localization | Secreted. |
Sequence Similarities | |
Aliases | A proliferation inducing ligand antibody|A proliferation-inducing ligand antibody|APRIL antibody|CD 256 antibody|CD256 antibody|CD256 antigen antibody|Ligand antibody|PRO715 antibody|Proliferation inducing ligand APRIL antibody|TALL 2 antibody|TALL-2 antibody|TALL2 antibody|TNF and APOL related leukocyte expressed ligand 2 antibody|TNF related death ligand 1 antibody|TNF related death ligand antibody|TNF- and APOL-related leukocyte expressed ligand 2 antibody|TNF-related death ligand 1 antibody| TNF13_ HUMAN antibody|TNFSF 13 antibody|TNFSF13 antibody|TNFSF13 protein antibody|TRDL 1 antibody|TRDL-1 antibody|TRDL1 antibody|Tumor necrosis factor (ligand) superfamily member 13 antibody|Tumor necrosis factor (ligand) superfamily, member 13 antibody|Tumor necrosis factor ligand superfamily member 13 antibody|Tumor necrosis factor like protein ZTNF2 antibody|Tumor necrosis factor related death ligand antibody|Tumor necrosis factor related death ligand 1 antibody|Tumor necrosis factor superfamily member 13 antibody|TWE PRIL antibody|UNQ383 antibody| UNQ383/ PRO715 antibody| ZTNF 2 antibody|ZTNF2 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |
| ELISA | 0.1-0.5μg/ml | Human | Sandwich ELISA format |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti-APRIL antibody, ASA-B0130, Western blotting
All lanes: Anti APRIL (ASA-B0130) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: COLO320 Whole Cell Lysate at 40ug
Lane 3: SW620 Whole Cell Lysate at 40ug
Lane 4: JURKAT Whole Cell Lysate at 40ug
Lane 5: RAJI Whole Cell Lysate at 40ug
Lane 6: U937 Whole Cell Lysate at 40ug
Predicted band size: 27KD
Observed band size: 27KD
All lanes: Anti APRIL (ASA-B0130) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: COLO320 Whole Cell Lysate at 40ug
Lane 3: SW620 Whole Cell Lysate at 40ug
Lane 4: JURKAT Whole Cell Lysate at 40ug
Lane 5: RAJI Whole Cell Lysate at 40ug
Lane 6: U937 Whole Cell Lysate at 40ug
Predicted band size: 27KD
Observed band size: 27KD