More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| APH1A gamma secretase subunit | Polyclonal | IgG | Rabbit | Human, Mouse | WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the C-terminus of human APH1a (236-265aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | APH1A |
Protein | Gamma-secretase subunit APH-1 |
Uniprot ID | Q96BI3 |
Function | Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex. |
Tissue Specificity | Widely expressed. Expressed in leukocytes, lung, placenta, small intestine, liver, kidney, spleen thymus, skeletal muscle, heart and brain. Isoform 1 and isoform 2 are nearly expressed at the same level. |
Sub-cellular localization | Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, Golgi stack membrane; Multi- pass membrane protein. Note: Predominantly located in the endoplasmic reticulum and in the cis-Golgi. |
Sequence Similarities | Belongs to the APH-1 family. |
Aliases | 6530402N02Rik antibody|AL138795.3 antibody|Anterior Pharynx Defective 1 antibody|Anterior pharynx defective 1 homolog A antibody|APH 1A antibody|Aph 1alpha antibody|APH-1a antibody| Aph-1alpha antibody|Aph1a antibody|APH1A gamma secretase subunit antibody|APH1A_HUMAN antibody|CGI 78 antibody| CGI78 antibody|Gamma secretase subunit APH 1A antibody|Gamma Secretase Subunit APH1a antibody|Gamma-secretase subunit APH-1A antibody|Likely ortholog of C. elegans anterior pharynx defective 1A antibody|Presenilin Stabilization Factor antibody| Presenilin-stabilization factor antibody|PSF antibody| UNQ579/PRO1141 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- APH1a antibody, ASA-B0116, Western blotting
All lanes: Anti APH1a (ASA-B0116) at 0.5ug/ml
Lane 1: Mouse Lung Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: SW620 Whole Cell Lysate at 40ug
Lane 4: SMMC Whole Cell Lysate at 40ug
Lane 5: Human Placenta Tissue Lysate at 50ug
Predicted band size: 29KD
Observed band size: 29KD