More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
ATP-binding cassette, sub-family A (ABC1), member 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA1 (2231-2261aa KDLSLHKNQTVVDVAVLTSFLQDEKVKESYV), identical to the related mouse sequence. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | ABCA1 |
Protein | ATP-binding cassette sub-family A member 1 |
Uniprot ID | O95477 |
Function | cAMP-dependent and sulfonylurea-sensitive anion transporter. Key gatekeeper influencing intracellular cholesterol transport. |
Tissue Specificity | Widely expressed, but most abundant in macrophages. |
Sub-cellular localization | Membrane. |
Sequence Similarities | Belongs to the ABC transporter superfamily. ABCA family. |
Aliases | ABC 1 antibody|ABC Transporter 1 antibody|ABC-1 antibody|ABC1 antibody|ABCA 1 antibody| ABCA1 antibody|ABCA1_HUMAN antibody|ATP binding Cassette 1 antibody|ATP binding cassette sub family A ABC1 member 1 antibody|ATP binding cassette sub family A member 1 antibody|ATP binding Cassette Transporter 1 antibody|ATP-binding cassette 1 antibody|ATP-binding cassette sub-family A member 1 antibody|ATP-binding cassette transporter 1 antibody|CERP antibody|Cholesterol efflux regulatory protein antibody|FLJ14958 antibody| HDLDT1 antibody|Membrane bound antibody|MGC164864 antibody|MGC165011 antibody|TD antibody|TGD antibody |
Application Details
Application | Concentration* | Species | Validated Using** |
Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- ABCA1 antibody, ASA-B0012, Western blotting
All lanes: Anti ABCA1 (ASA-B0012) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: SMMC Whole Cell Lysate at 40ug
Predicted band size: 254KD
Observed band size: 254KD