More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| potassium channel, voltage gated shaker related subfamily A, member 3 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human KCNA3 (513-544aa EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ), identical to the related mouse and rat sequences. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | KCNA3 |
Protein | Potassium voltage-gated channel subfamily A member 3 |
Uniprot ID | P22001 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | HGK 5 antibody|HGK5 antibody|HLK 3 antibody|HLK3 antibody|HPCN 3 antibody|HPCN3 antibody|HuKIII antibody|KCNA 3 antibody|Kcna3 antibody|KCNA3_HUMAN antibody|KV1.3 antibody|MK 3 antibody|MK3 antibody|OTTHUMP00000032397 antibody|PCN 3 antibody|PCN3 antibody| Potassium channel 3 antibody|Potassium voltage gated channel shaker related subfamily member 3 antibody|Potassium voltage gated channel subfamily A member 3 antibody|Potassium voltage-gated channel subfamily A member 3 antibody|Type n potassium channel antibody|Voltage gated potassium channel protein Kv1.3 antibody|Voltage gated potassium channel subunit Kv1.3 antibody|Voltage-gated K(+) channel HuKIII antibody|Voltage-gated potassium channel subunit Kv1.3 antibody |
Application Details
Anti- KCNA3 antibody, ASA-B1105, Western blotting
All lanes: Anti KCNA3 (ASA-B1105) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Lane 3: K562 Whole Cell Lysate at 40ug
Lane 4: HELA Whole Cell Lysate at 40ug
Lane 5: 22RV1 Whole Cell Lysate at 40ug
Predicted bind size: 64KD
Observed bind size: 55KD
All lanes: Anti KCNA3 (ASA-B1105) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Lane 3: K562 Whole Cell Lysate at 40ug
Lane 4: HELA Whole Cell Lysate at 40ug
Lane 5: 22RV1 Whole Cell Lysate at 40ug
Predicted bind size: 64KD
Observed bind size: 55KD
