JNK2 Antibody View larger

JNK2 Antibody

ASA-B1087

$349.80

More info

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

mitogen-activated protein kinase 9 Polyclonal IgG Rabbit Human WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human JNK2 (257-288aa RNYVENRPKYPGIKFEELFPDWIFPSESERDK), identical to the related mouse and rat sequences.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

MAPK9

Protein

Mitogen-activated protein kinase 9

Uniprot ID

P45984

Function

Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as proinflammatory cytokines or physical stress stimulate the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK9/JNK2. In turn, MAPK9/JNK2 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN and ATF2 and thus regulates AP-1 transcriptional activity. In response to oxidative or ribotoxic stresses, inhibits rRNA synthesis by phosphorylating and inactivating the RNA polymerase 1-specific transcription initiation factor RRN3. Promotes stressed cell apoptosis by phosphorylating key regulatory factors including TP53 and YAP1. In T-cells, MAPK8 and MAPK9 are required for polarized differentiation of T-helper cells into Th1 cells. Upon T-cell receptor (TCR) stimulation, is activated by CARMA1, BCL10, MAP2K7 and MAP3K7/TAK1 to regulate JUN protein levels. Plays an important role in the osmotic stress-induced epithelial tight-junctions disruption. When activated, promotes beta-catenin/CTNNB1 degradation and inhibits the canonical Wnt signaling pathway. Participates also in neurite growth in spiral ganglion neurons. Phosphorylates the CLOCK-ARNTL/BMAL1 heterodimer and plays a role in the regulation of the circadian clock (PubMed:22441692).

Tissue Specificity

Sub-cellular localization

Cytoplasm.

Sequence Similarities

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.

Aliases

c Jun kinase 2 antibody|C Jun N terminal kinase 2 antibody|c-Jun N-terminal kinase 2 antibody|JNK 55 antibody|JNK-55 antibody|JNK2 alpha antibody|JNK2 antibody|JNK2 beta antibody|JNK2A antibody|JNK2alpha antibody|JNK2B antibody|JNK2BETA antibody|Jun kinase antibody|MAP kinase 9 antibody|MAPK 9 antibody|Mapk9 antibody|Mitogen activated protein kinase 9 antibody|Mitogen-activated protein kinase 9 antibody|MK09_HUMAN antibody|P54a antibody| p54aSAPK antibody|PRKM9 antibody|SAPK alpha antibody|SAPK antibody| SAPK1a antibody|Stress activated protein kinase 1a antibody|Stress-activated protein kinase JNK2 antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml HumanAssaySolutio's ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- JNK2 antibody, ASA-B1087, Western blotting
All lanes: Anti JNK2 (ASA-B1087) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: COLO320 Whole Cell Lysate at 40ug
Predicted bind size: 48KD
Observed bind size: 48KD

© 2024 Novateinbio.com