More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
mitogen-activated protein kinase 9 | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human JNK2 (257-288aa RNYVENRPKYPGIKFEELFPDWIFPSESERDK), identical to the related mouse and rat sequences. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | MAPK9 |
Protein | Mitogen-activated protein kinase 9 |
Uniprot ID | P45984 |
Function | Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as proinflammatory cytokines or physical stress stimulate the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK9/JNK2. In turn, MAPK9/JNK2 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN and ATF2 and thus regulates AP-1 transcriptional activity. In response to oxidative or ribotoxic stresses, inhibits rRNA synthesis by phosphorylating and inactivating the RNA polymerase 1-specific transcription initiation factor RRN3. Promotes stressed cell apoptosis by phosphorylating key regulatory factors including TP53 and YAP1. In T-cells, MAPK8 and MAPK9 are required for polarized differentiation of T-helper cells into Th1 cells. Upon T-cell receptor (TCR) stimulation, is activated by CARMA1, BCL10, MAP2K7 and MAP3K7/TAK1 to regulate JUN protein levels. Plays an important role in the osmotic stress-induced epithelial tight-junctions disruption. When activated, promotes beta-catenin/CTNNB1 degradation and inhibits the canonical Wnt signaling pathway. Participates also in neurite growth in spiral ganglion neurons. Phosphorylates the CLOCK-ARNTL/BMAL1 heterodimer and plays a role in the regulation of the circadian clock (PubMed:22441692). |
Tissue Specificity | |
Sub-cellular localization | Cytoplasm. |
Sequence Similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. |
Aliases | c Jun kinase 2 antibody|C Jun N terminal kinase 2 antibody|c-Jun N-terminal kinase 2 antibody|JNK 55 antibody|JNK-55 antibody|JNK2 alpha antibody|JNK2 antibody|JNK2 beta antibody|JNK2A antibody|JNK2alpha antibody|JNK2B antibody|JNK2BETA antibody|Jun kinase antibody|MAP kinase 9 antibody|MAPK 9 antibody|Mapk9 antibody|Mitogen activated protein kinase 9 antibody|Mitogen-activated protein kinase 9 antibody|MK09_HUMAN antibody|P54a antibody| p54aSAPK antibody|PRKM9 antibody|SAPK alpha antibody|SAPK antibody| SAPK1a antibody|Stress activated protein kinase 1a antibody|Stress-activated protein kinase JNK2 antibody |
Application Details
Application | Concentration* | Species | Validated Using** |
Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- JNK2 antibody, ASA-B1087, Western blotting
All lanes: Anti JNK2 (ASA-B1087) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: COLO320 Whole Cell Lysate at 40ug
Predicted bind size: 48KD
Observed bind size: 48KD