More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| inhibitor of growth family, member 1 | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence in the middle region of human ING1 (192-223aa KELDECYERFSRETDGAQKRRMLHCVQRALIR), different from the related mouse sequence by seven amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | ING1 |
Protein | Inhibitor of growth protein 1 |
Uniprot ID | Q9UK53 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | 2610028J21Rik antibody|AA407184 antibody|AI875420 antibody|Growth inhibitor ING 1 antibody|Growth inhibitor ING1 antibody|Growth inhibitory protein ING 1 antibody|Growth inhibitory protein ING1 antibody|Homo sapiens growth inhibitor p33ING1 (ING1) mRNA, complete cds antibody|ING 1 antibody|Ing1 antibody|ING1_HUMAN antibody|Inhibitor of growth 1 antibody|Inhibitor of growth family member 1 antibody| Inhibitor of growth protein 1 antibody|mING1h antibody|OTTHUMP00000018703 antibody|OTTHUMP00000018704 antibody| OTTHUMP00000018705 antibody|OTTHUMP00000018706 antibody|p24ING1c antibody|p33 antibody|p33 ING1 antibody|p33ING1 antibody| p33ING1b antibody|p33ING1c antibody|p37Ing1b antibody|p47 antibody|p47ING1a antibody|Tumor suppressor ING 1 antibody|Tumor suppressor ING1 antibody |
Application Details
Anti- ING1 antibody, ASA-B1035, Western blotting
All lanes: Anti ING1 (ASA-B1035) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: A549 Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 47KD
All lanes: Anti ING1 (ASA-B1035) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: A549 Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 47KD
