More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| insulin-like growth factor binding protein 2, 36kDa | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP2 (228-257aa QQELDQVLERISTMRLPDERGPLEHLYSLH), different from the related mouse and rat sequences by one amino acid. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | IGFBP2 |
Protein | Insulin-like growth factor-binding protein 2 |
Uniprot ID | P18065 |
Function | Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. |
Tissue Specificity | |
Sub-cellular localization | Secreted. |
Sequence Similarities | Contains 1 IGFBP N-terminal domain. |
Aliases | BP 2 antibody|BP2 antibody|IBP 2 antibody|IBP-2 antibody|IBP2 antibody|IBP2_HUMAN antibody|IGF binding protein 2 antibody|IGF BP53 antibody|IGF-binding protein 2 antibody|IGFBP 2 antibody|IGFBP-2 antibody|IGFBP2 antibody|IGFBP53 antibody|Insulin like growth factor binding protein 2 36kDa antibody|Insulin like growth factor binding protein 2 antibody|Insulin like growth factor-binding protein 2 precursor antibody|Insulin-like growth factor-binding protein 2 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- IGFBP2 antibody, ASA-B0975, Western blotting
All lanes: Anti IGFBP2 (ASA-B0975) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Liver Tissue Lysate at 50ug
Lane 3: Human Placenta Tissue Lysate at 50ug
Predicted bind size: 35KD
Observed bind size: 35KD