More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| insulin-like growth factor binding protein 1 | Polyclonal | IgG | Rabbit | Mouse, Rat | ELISA, WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | IGFBP1 |
Protein | Insulin-like growth factor-binding protein 1 |
Uniprot ID | P47876 |
Function | IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity). |
Tissue Specificity | |
Sub-cellular localization | Secreted. |
Sequence Similarities | Contains 1 IGFBP N-terminal domain. |
Aliases | AFBP antibody|Alpha pregnancy associated endometrial globulin antibody|Amniotic fluid binding protein antibody|Binding protein 25 antibody| Binding protein 26 antibody|Binding protein 28 antibody|Growth hormone independent binding protein antibody|hIGFBP 1 antibody|hIGFBP1 antibody|IBP 1 antibody|IBP-1 antibody|IBP1 antibody|IBP1_HUMAN antibody|IGF binding protein 1 antibody|IGF BP25 antibody|IGF-binding protein 1 antibody|IGFBP 1 antibody|IGFBP-1 antibody|IGFBP1 antibody|Insulin Like Growth Factor Binding Protein 1 antibody|Insulin-like growth factor-binding protein 1 antibody|Placental protein 12 antibody|PP 12 antibody|PP12 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Mouse, Rat | AssaySolutio's ECL kit |
| ELISA | 0.1-0.5μg/ml | Mouse | Sandwich ELISA format |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- IGFBP1 antibody, ASA-B0974, Western blotting
All lanes: Anti IGFBP1 (ASA-B0974) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Mouse Kidney Tissue Lysate at 50ug
Predicted bind size: 28KD
Observed bind size: 28KD