More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| islet cell autoantigen 1, 69kDa | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | ICA1 |
Protein | Islet cell autoantigen 1 |
Uniprot ID | Q05084 |
Function | May play a role in neurotransmitter secretion. |
Tissue Specificity | Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid. |
Sub-cellular localization | Cytoplasm, cytosol. |
Sequence Similarities | |
Aliases | 69 kDa islet cell autoantigen antibody|Diabetes mellitus type I autoantigen antibody|ICA 1 antibody|Ica1 antibody|ICA69 antibody|ICA69_HUMAN antibody| ICAp69 antibody|Islet cell autoantigen 1 (69kD) antibody|Islet cell autoantigen 1 69kDa antibody|Islet cell autoantigen 1 antibody|Islet cell autoantigen 1 isoform antibody|Islet cell autoantigen p69 antibody|OTTHUMP00000200933 antibody| OTTHUMP00000200934 antibody|OTTHUMP00000200941 antibody| OTTHUMP00000200993 antibody|p69 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Mouse, Rat Human | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- ICA1 antibody, ASA-B0962, Western blotting
All lanes: Anti ICA1 (ASA-B0962) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Pancreas Tissue Lysate at 50ug
Predicted bind size: 55KD
Observed bind size: 55KD