More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| hexokinase domain containing 1 | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the N-terminus of human HKDC1(102-136aa KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD), different from the related mouse sequence by four amino acids. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | HKDC1 |
Protein | Putative hexokinase HKDC1 |
Uniprot ID | Q2TB90 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | Belongs to the hexokinase family. |
Aliases | BC016235 antibody|Hexokinase domain-containing protein 1 antibody|Hkdc1 antibody|HKDC1_HUMAN antibody|Putative hexokinase HKDC1 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti-HKDC1 antibody, ASA-B0870, Western blotting
All lanes: Anti HKDC1 (ASA-B0870) at 0.5ug/ml
Lane 1: 293T Whole Cell Lysate at 40ug
Lane 2: SW620 Whole Cell Lysate at 40ug
Lane 3: COLO320 Whole Cell Lysate at 40ug
Lane 4: HELA Whole Cell Lysate at 40ug
Predicted bind size: 103KD
Observed bind size: 170KD