More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| tumor susceptibility 101 | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the C-terminus of human TSG101 (361-390aa KHVRLLSRKQFQLRALMQKARKTAGLSDLY), identical to the related mouse and rat sequences. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | TSG101 |
Protein | Tumor susceptibility gene 101 protein |
Uniprot ID | Q99816 |
Function | Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. |
Tissue Specificity | Heart, brain, placenta, lung, liver, skeletal, kidney and pancreas. |
Sub-cellular localization | Cytoplasm. Membrane; Peripheral membrane protein. Nucleus. Late endosome membrane; Peripheral membrane protein. Note: Mainly cytoplasmic. Membrane-associated when active and soluble when inactive. Depending on the stage of the cell cycle, detected in the nucleus. Colocalized with CEP55 in the midbody during cytokinesis. |
Sequence Similarities | Belongs to the ubiquitin-conjugating enzyme family. UEV subfamily. |
Aliases | ESCRT I complex subunit TSG101 antibody|ESCRT-I complex subunit TSG101 antibody|TS101_HUMAN antibody|TSG 10 antibody|TSG 101 antibody||TSG10 antibody|Tsg101 antibody|Tumor susceptibility gene 10 antibody|Tumor susceptibility gene 101 antibody|Tumor susceptibility gene 101 protein antibody| Tumor susceptibility protein antibody|Tumor susceptibility protein isoform 3 antibody|VPS 23 antibody|VPS23 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- TSG101 antibody, ASA-B1940, Western blotting
All lanes: Anti TSG101 (ASA-B1940) at 0.5ug/ml
Lane 1: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 2: Rat Brain Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 44KD
Observed bind size: 44KD