TRPV5  Antibody View larger

TRPV5 Antibody

ASA-B1937

$386.90

More info

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

transient receptor potential cation channel, subfamily V, member 5 Polyclonal IgG Rabbit Human, Rat WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human TRPV5 (580-610aa DTHWRVAQERDELWRAQVVATTVMLERKLPR), different from the related mouse and rat sequences by one amino acid.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

TRPV5

Protein

Transient receptor potential cation channel subfamily V member 5

Uniprot ID

Q9NQA5

Function

Constitutively active calcium selective cation channel thought to be involved in Ca(2+) reabsorption in kidney and intestine. The channel is activated by low internal calcium level and the current exhibits an inward rectification. A Ca(2+)- dependent feedback regulation includes fast channel inactivation and slow current decay. Heteromeric assembly with TRPV6 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating (By similarity).

Tissue Specificity

Expressed at high levels in kidney, small intestine and pancreas, and at lower levels in testis, prostate, placenta, brain, colon and rectum.

Sub-cellular localization

Apical cell membrane.

Sequence Similarities

Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV5 sub-subfamily.

Aliases

Calcium transport protein 2 antibody|Calcium transporter 2 antibody|CAT 2 antibody|CAT2 antibody|ECAC 1 antibody|ECaC antibody|ECAC1 antibody| Epithelial calcium channel 1 antibody|Osm 9 like TRP channel 3 antibody|Osm-9-like TRP channel 3 antibody|OTRPC 3 antibody|OTRPC3 antibody|Transient receptor potential cation channel subfamily V member 5 antibody|TRPV 5 antibody|TrpV5 antibody|TRPV5_HUMAN antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, RatAssaySolutio's ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- TRPV5 antibody, ASA-B1937, Western blotting
All lanes: Anti TRPV5 (ASA-B1937) at 0.5ug/ml
Lane 1: Rat Pancreas Tissue Lysate at 50ug
Lane 2: Rat Lung Tissue Lysate at 50ug
Lane 3: Rat Intestine Tissue Lysate at 50ug
Lane 4: SW620 Whole Cell Lysate at 40ug
Lane 5: COLO320 Whole Cell Lysate at 40ug
Lane 6: 293T Whole Cell Lysate at 40ug
Predicted bind size: 83KD
Observed bind size: 83KD

© 2024 Novateinbio.com