View larger

Protein G Recombinant ( Protein G )

DescriptionRecombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using

$201.00

Data sheet

Storage Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Protein G should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Formulation Lyophilized white powder containing no additives.
Purity >96% as determined by SDS-PAGE and RP-HPLC.
Description Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The Protein G contains 200 amino acids (190-384 and five additional residues not including methionine) having a molecular mass of 21.8kDa. The Protein-G migrates on SDS-PAGE around 32kDa.
Expression host Escherichia Coli.
Reagent Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Amino acid sequence LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.

© 2024 Novateinbio.com