Warning: Last items in stock!
Availability date:
Receptor Associated Protein Rat Recombinant ( RAP Rat )
DescriptionRecombinant Rat Receptor Associated Protein produced in E.Coli is a single, non-glycosylated polypeptide chain having a molecular mass of 38,862 Dalton. The Recombinant RAP Rat contains 6xHis tag and 1xC-myc, RAP Rat is purified byRecipient :
* Required fields
or Cancel
Formulation | The protein (1mg/ml) was lyophilized after from a sterile solution containing TBS pH-7.5, 0.1% BSA and 0.09% NaN3. |
Solubility | It is recommended to reconstitute the lyophilized RAP Rat in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions. |
Purity | Greater than 95.0% as determined by SDS-PAGE. |
Description | Recombinant Rat Receptor Associated Protein produced in E.Coli is a single, non-glycosylated polypeptide chain containing 327 amino acids and having a molecular mass of 38,862 Dalton. The Recombinant RAP Rat contains 6xHis tag and 1xC-myc, RAP Rat is purified by proprietary chromatographic techniques. |
Protein Background | Receptor-associated Protein (aka RAP) averts the GCM-mediated enhancement of axon growth- ApoE-containing lipoproteins which are known to bind to receptors of the LDLr superfamily. In the presence of RAP, GCM doesnt increase the axon extension rate in relation to base medium. Furthermore, the addition of RAP to the base medium doesnt change the rate of axon extension. This implies that the growth stimulatory effect of apoE-containing lipoproteins secreted by glial cells is mediated by the LDLr family receptors. RAP annuls the growth stimulatory effect of GCM. |
Expression host | Escherichia Coli. |
Synonyms | Receptor Associated Protein, RAP. |
Reagent Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Stability | Lyophilized RAP Rat although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution RAP Rat should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Amino acid sequence | MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR LRKVSHQGYGPATEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQ LEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL. |