View larger
Small Ubiquitin-Related Modifier 2 Human Recombinant ( SUMO2 Human )
DescriptionSUMO2 Human Recombinant full length protein expressed in E.coli, shows a 36 kDa band on SDS-PAGE(including GST tag).The SUMO2 is purified by proprietary chromatographic techniques.SourceEscherichia Coli.Physical AppearanceSterile Filtered
Data sheet
| Formulation | The SUMO2 (1mg/ml) containing 20mM Tris-HCl buffer (pH 8.0). |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Description | SUMO2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 93 amino acids and having a molecular mass of 10.6 kDa.The SUMO-2 is purified by proprietary chromatographic techniques. |
| Protein Background | Small Ubiquitin-like Modifiers (SUMOs) are a family of small, related proteins that can be enzymatically attached to a target protein by a post-translational modification process termed sumoylation. Unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. All SUMO proteins share the conserved ubiquitin domain and the C-terminal diglycine cleavage/attachment site. Human SUMO2, also known as Sentrin2 and SMT3B is synthesized as a 95 amino acid (aa), 11 kDa propeptide that contains a two aa C-terminal prosegment, and an 18 aa N-terminal protein interacting region (aa 33 -50). Following prosegment cleavage, the C-terminal glycine is enzymatically attached to a lysine on a target protein. Human SUMO2 shares 100% sequence identity to SUMO-2 from mouse. SUMO2 also has very high sequence homology to SUMO3 and SUMO4, 86 % and 85%, respectively. SUMO2 shares only 44% sequence identity to SUMO1. |
| Expression host | Escherichia Coli. |
| Synonyms | Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191. |
| Reagent Appearance | Sterile filtered colorless solution. |
| Stability | Can be stored at +4C for 1 week. For long term storage , below -20C.Please prevent freeze-thaw cycles. |
| Amino acid sequence | MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG. |