More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| ATP-binding cassette, sub-family B (MDR/TAP), member 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, IHC-F | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Thimerosal and 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | 1853 |
Protein | Multidrug resistance protein 1 |
Uniprot ID | P08183 |
Function | Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells. |
Tissue Specificity | Expressed in liver, kidney, small intestine and brain. |
Sub-cellular localization | Cell membrane ; Multi-pass membrane protein. |
Sequence Similarities | Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily. |
Aliases | ABC20 antibody|ABCB1 antibody|ATP binding cassette, sub family B (MDR/TAP), member 1 antibody|ATP-binding cassette sub-family B member 1 antibody|CD243 antibody|CLCS antibody|Colchicin sensitivity antibody|Doxorubicin resistance antibody|GP170 antibody|MDR1 antibody|MDR1_HUMAN antibody|Multidrug resistance 1 antibody|Multidrug resistance protein 1 antibody|P glycoprotein 1 antibody|P gp antibody|P-glycoprotein 1 antibody|PGY1 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio's IHC/ICC Detection kit |
| Immunohistochemistry(Frozen Section) | 0.5-1μg/ml | Mouse, Rat | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P) and IHC(F). *Blocking peptide can be purchased at $65. Contact us for more information
Anti-P Glycoprotein antibody, ASA-B1445--1.jpg
IHC(F): Mouse Intestine Tissue
IHC(F): Mouse Intestine Tissue
Anti-P Glycoprotein antibody, ASA-B1445--2.jpg
IHC(F): Rat Kidney Tissue
IHC(F): Rat Kidney Tissue
Anti-P Glycoprotein antibody, ASA-B1445--3.jpg
IHC(P): Human Lung Cancer Tissue
IHC(P): Human Lung Cancer Tissue