More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| transmembrane protein 173 | Polyclonal | IgG | Rabbit | Human | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human TMEM173 (284-316aa RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE), different from the related mouse sequence by five amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | TMEM173 |
Protein | Stimulator of interferon genes protein |
Uniprot ID | Q86WV6 |
Function | Facilitator of innate immune signaling that acts as a sensor of cytosolic DNA from bacteria and viruses and promotes the production of type I interferon (IFN-alpha and IFN-beta). Innate immune response is triggered in response to non-CpG double- stranded DNA from viruses and bacteria delivered to the cytoplasm. Acts by recognizing and binding cyclic di-GMP (c-di-GMP), a second messenger produced by bacteria, and cyclic GMP-AMP (cGAMP), a messenger produced in response to DNA virus in the cytosol: upon binding of c-di-GMP or cGAMP, autoinhibition is alleviated and TMEM173/STING is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon and exert a potent anti-viral state. May be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons. May be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). Mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Essential for the induction of IFN-beta in response to human herpes simplex virus 1 (HHV-1) infection. |
Tissue Specificity | Ubiquitously expressed. Expressed in skin endothelial cells, alveolar type 2 pneumocytes, bronchial epithelium and alveolar macrophages. |
Sub-cellular localization | Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein. Cell membrane ; Multi-pass membrane protein . Cytoplasm, perinuclear region. Cytoplasm. Note: In response to double-stranded DNA stimulation, relocalizes to perinuclear region, where the kinase TBK1 is recruited. |
Sequence Similarities | |
Aliases | endoplasmic reticulum IFN stimulator antibody|Endoplasmic reticulum interferon stimulator antibody|ERIS antibody|FLJ38577 antibody|hMITA antibody|hSTING antibody|Mediator of IRF3 activation antibody|MITA antibody|Mitochondrial mediator of IRF3 activation antibody|MPYS antibody|N terminal methionine proline tyrosine serine plasma membrane tetraspanner antibody|NET23 antibody| Stimulator of interferon genes antibody|Stimulator of interferon genes protein antibody|STING antibody|TM173_HUMAN antibody|Tmem173 antibody| Transmembrane protein 173 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- TMEM173 antibody, ASA-B1881, Western blotting
All lanes: Anti TMEM173 (ASA-B1881) at 0.5ug/ml
Lane 1: A549 Whole Cell Lysate at 40ug
Lane 2: HELA Whole Cell Lysate at 40ug
Predicted bind size: 42KD
Observed bind size: 42KD
All lanes: Anti TMEM173 (ASA-B1881) at 0.5ug/ml
Lane 1: A549 Whole Cell Lysate at 40ug
Lane 2: HELA Whole Cell Lysate at 40ug
Predicted bind size: 42KD
Observed bind size: 42KD
Anti- TMEM173 antibody, ASA-B1881, IHC(P)
IHC(P): Human Lung Cancer Tissue
IHC(P): Human Lung Cancer Tissue
