More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| tyrosine hydroxylase | Polyclonal | IgG | Rabbit | Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence in the middle region of human TH (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | TH |
Protein | Tyrosine 3-monooxygenase |
Uniprot ID | P07101 |
Function | Plays an important role in the physiology of adrenergic neurons. |
Tissue Specificity | Mainly expressed in the brain and adrenal glands. |
Sub-cellular localization | |
Sequence Similarities | Belongs to the biopterin-dependent aromatic amino acid hydroxylase family. |
Aliases | Dystonia 14 antibody|DYT14 antibody|DYT5b antibody|EC 1.14.16.2 antibody| OTTHUMP00000011225 antibody|OTTHUMP00000011226 antibody|ple antibody| Protein Pale antibody|TH antibody|The antibody|TY3H_HUMAN antibody|TYH antibody|Tyrosine 3 hydroxylase antibody|Tyrosine 3 monooxygenase antibody| Tyrosine 3-hydroxylase antibody|Tyrosine 3-monooxygenase antibody| Tyrosine hydroxylase antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Mouse, Rat Human | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Mouse, Rat Human | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- TH antibody, ASA-B1855, Western blotting
All lanes: Anti TH (ASA-B1855) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Predicted bind size: 59KD
Observed bind size: 59KD
All lanes: Anti TH (ASA-B1855) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Predicted bind size: 59KD
Observed bind size: 59KD
Anti- TH antibody, ASA-B1855,IHC(P)
IHC(P): Mouse Brain Tissue
IHC(P): Mouse Brain Tissue
Anti- TH antibody, ASA-B1855,IHC(P)
IHC(P): Rat Brain Tissue
IHC(P): Rat Brain Tissue