TH Antibody

Overview

Long Name	Antibody Type	Antibody Isotype	Host	Species Reactivity	Validated Applications	Purification
tyrosine hydroxylase	Polyclonal	IgG	Rabbit	Mouse, Rat	IHC-P, WB	Immunogen affinity purified.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human TH (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences.

Properties

Form	Lyophilized
Size	100 µg/vial
Contents	Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.
Concentration	Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).
Storage	At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene	TH
Protein	Tyrosine 3-monooxygenase
Uniprot ID	P07101
Function	Plays an important role in the physiology of adrenergic neurons.
Tissue Specificity	Mainly expressed in the brain and adrenal glands.
Sub-cellular localization
Sequence Similarities	Belongs to the biopterin-dependent aromatic amino acid hydroxylase family.
Aliases	Dystonia 14 antibody|DYT14 antibody|DYT5b antibody|EC 1.14.16.2 antibody| OTTHUMP00000011225 antibody|OTTHUMP00000011226 antibody|ple antibody| Protein Pale antibody|TH antibody|The antibody|TY3H_HUMAN antibody|TYH antibody|Tyrosine 3 hydroxylase antibody|Tyrosine 3 monooxygenase antibody| Tyrosine 3-hydroxylase antibody|Tyrosine 3-monooxygenase antibody| Tyrosine hydroxylase antibody

Application Details

Application	Concentration*	Species	Validated Using**
Western blot	0.1-0.5μg/ml	Mouse, Rat Human	AssaySolutio's ECL kit
Immunohistochemistry(Paraffin-embedded Section)	0.5-1μg/ml	Mouse, Rat Human	AssaySolutio's IHC/ICC Detection kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information