More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| Sp5 transcription factor | Polyclonal | IgG | Rabbit | Human | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence in the middle region of human Sp5 (246-275aa DFAQYQSQIAALLQTKAPLAATARRCRRCR), identical to the related mouse sequence. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | SP5 |
Protein | Transcription factor Sp5 |
Uniprot ID | Q6BEB4 |
Function | Binds to GC boxes promoters elements. Probable transcriptional activator that has a role in the coordination of changes in transcription required to generate pattern in the developing embryo (By similarity). |
Tissue Specificity | |
Sub-cellular localization | Nucleus . |
Sequence Similarities | Belongs to the Sp1 C2H2-type zinc-finger protein family. |
Aliases | Transcription factor Sp5 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- SP5 antibody, ASA-B1769, Western blotting
All lanes: Anti SP5 (ASA-B1769) at 0.5ug/ml
WB: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 42KD
Observed bind size: 42KD
All lanes: Anti SP5 (ASA-B1769) at 0.5ug/ml
WB: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 42KD
Observed bind size: 42KD
Anti- SP5 antibody, ASA-B1769, IHC(P)
IHC(P): Human Placenta Tissue
IHC(P): Human Placenta Tissue
