More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
superoxide dismutase 2, mitochondrial | Polyclonal | IgG | Rabbit | Human, Mouse | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by four amino acids. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | SOD2 |
Protein | Superoxide dismutase [Mn], mitochondrial |
Uniprot ID | P04179 |
Function | Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. |
Tissue Specificity | |
Sub-cellular localization | Mitochondrion matrix. |
Sequence Similarities | Belongs to the iron/manganese superoxide dismutase family. |
Aliases | Indophenoloxidase B antibody|IPO B antibody|IPOB antibody|Manganese containing superoxide dismutase antibody|Manganese SOD antibody| Manganese superoxide dismutase antibody|Mangano superoxide dismutase antibody|Mn SOD antibody|Mn superoxide dismutase antibody|MNSOD antibody| MVCD6 antibody|SOD 2 antibody|SOD-2 antibody|SOD2 antibody|SODM_HUMAN antibody| Superoxide dismutase [Mn] mitochondrial antibody|Superoxide dismutase [Mn] mitochondrial precursor antibody|Superoxide dismutase [Mn], mitochondrial antibody|Superoxide dismutase 2 mitochondrial antibody |
Application Details
Application | Concentration* | Species | Validated Using** |
Western blot | 0.1-0.5μg/ml | Human, Mouse | AssaySolutio's ECL kit |
Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti-SOD2 antibody, ASA-B1752, Western blotting
All lanes: Anti SOD2 (ASA-B1752) at 0.5ug/ml
Lane 1: Mouse Testis Tissue Lysate at 50ug
Lane 2: Mouse Lung Tissue Lysate at 50ug
Lane 3: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 4: Mouse Liver Tissue Lysate at 50ug
Lane 5: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 25KD
Observed bind size: 25KD
Anti-SOD2 antibody, ASA-B1752, IHC(P)
IHC(P): Human Mammary Cancer Tissue