SMN1/2  Antibody View larger

SMN1/2 Antibody

ASA-B1736

$386.90

More info

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

survival of motor neuron 1, telomeric/survival of motor neuron 2, centromeric Polyclonal IgG Rabbit Human, Mouse, Rat IHC-P, WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2(22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

SMN1/2

Protein

Survival motor neuron protein

Uniprot ID

Q16637

Function

The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. Ensures the correct splicing of U12 intron-containing genes that may be important for normal motor and proprioceptive neurons development. May also play a role in the metabolism of small nucleolar ribonucleoprotein (snoRNPs).

Tissue Specificity

Expressed in a wide variety of tissues. Expressed at high levels in brain, kidney and liver, moderate levels in skeletal and cardiac muscle, and low levels in fibroblasts and lymphocytes. Also seen at high levels in spinal cord. Present in osteoclasts and mononuclear cells (at protein level).

Sub-cellular localization

Cytoplasm. Nucleus, gem. Nucleus, Cajal body. Cytoplasmic granule. Cytoplasm, myofibril, sarcomere, Z line . Note: Colocalizes with Actn at the Z-line of skeletal muscle (By similarity). Under stress conditions colocalizes with RPP20/POP7 in punctuated cytoplasmic granules. Colocalized and redistributed with ZPR1 from the cytoplasm to nuclear gems (Gemini of coiled bodies) and Cajal bodies.

Sequence Similarities

Belongs to the SMN family.

Aliases

Component of gems 1 antibody|Component of gems 2 antibody|Gemin 1 antibody|Gemin-1 antibody|SMA antibody|SMA1 antibody|SMA3 antibody|SMN antibody|SMN_HUMAN antibody|SMN1 antibody|SMN2 antibody|SMNC antibody| SMNT antibody|Survival motor neuron protein antibody|survival of motor neuron 1, telomeric antibody|survival of motor neuron 2, centromeric antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Mouse, Rat AssaySolutio's ECL kit
Immunohistochemistry(Paraffin-embedded Section) 0.5-1μg/ml Human, Mouse, RatAssaySolutio's IHC/ICC Detection kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- SMN1/2 antibody, ASA-B1736, Western blotting
All lanes: Anti SMN1/2(ASA-B1736) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Lane 3: Rat Liver Tissue Lysate at 50ug
Lane 4: Mouse Liver Tissue Lysate at 50ug
Lane 5: 293T Whole Cell Lysate at 40ug
Lane 6: SMMC Whole Cell Lysate at 40ug
Lane 7: HEPG2 Whole Cell Lysate at 40ug
Lane 8: HELA Whole Cell Lysate at 40ug
Predicted bind size: 32KD
Obse
Anti- SMN1/2 antibody, ASA-B1736,IHC(P)
IHC(P): Mouse Brain Tissue
Anti- SMN1/2 antibody, ASA-B1736,IHC(P)
IHC(P): Rat Brain Tissue

© 2024 Novateinbio.com