SLC22A2 Antibody

Overview

Long Name	Antibody Type	Antibody Isotype	Host	Species Reactivity	Validated Applications	Purification
solute carrier family 22 (organic cation transporter), member 2	Polyclonal	IgG	Rabbit	Human, Mouse, Rat	IHC-P, WB	Immunogen affinity purified.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.

Properties

Form	Lyophilized
Size	100 µg/vial
Contents	Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.
Concentration	Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).
Storage	At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene	SLC22A2
Protein	Solute carrier family 22 member 2
Uniprot ID	O15244
Function	Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamin, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity.
Tissue Specificity	Mainly expressed in kidney. Localized at the luminal membrane and basolateral membrane of kidney distal tubule and proximal tubules. To a lower extent, expressed in neurons of the cerebral cortex and in various subcortical nuclei (at protein levels). Also detected in secretory phase endometrium; in scattered cells in the stroma.
Sub-cellular localization	Membrane ; Multi-pass membrane protein .
Sequence Similarities
Aliases	MGC32628 antibody|OCT 2 antibody|OCT2 antibody|Organic cation transporter 2 antibody|Organic cation transporter antibody|RP11-317M22.2 antibody|Solute carrier family 22 (organic cation transporter) member 2 antibody|Solute carrier family 22 member 2 antibody

Application Details

Application	Concentration*	Species	Validated Using**
Western blot	0.1-0.5μg/ml	Mouse, Rat Human	AssaySolutio's ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information