More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| solute carrier family 22 (organic cation transporter), member 2 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | SLC22A2 |
Protein | Solute carrier family 22 member 2 |
Uniprot ID | O15244 |
Function | Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamin, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity. |
Tissue Specificity | Mainly expressed in kidney. Localized at the luminal membrane and basolateral membrane of kidney distal tubule and proximal tubules. To a lower extent, expressed in neurons of the cerebral cortex and in various subcortical nuclei (at protein levels). Also detected in secretory phase endometrium; in scattered cells in the stroma. |
Sub-cellular localization | Membrane ; Multi-pass membrane protein . |
Sequence Similarities | |
Aliases | MGC32628 antibody|OCT 2 antibody|OCT2 antibody|Organic cation transporter 2 antibody|Organic cation transporter antibody|RP11-317M22.2 antibody|Solute carrier family 22 (organic cation transporter) member 2 antibody|Solute carrier family 22 member 2 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Mouse, Rat Human | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- SLC22A2 antibody, ASA-B1711, Western blotting
All lanes: Anti SLC22A2 (ASA-B1711) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Predicted bind size: 63KD
Observed bind size: 63KD
Anti- SLC22A2 antibody, ASA-B1711, IHC(P)
IHC(P): Mouse Kidney Tissue
Anti- SLC22A2 antibody, ASA-B1711, IHC(P)
IHC(P): Rat Kidney Tissue