More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| solute carrier family 12 (sodium/potassium/chloride transporters), member 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1(52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | SLC12A1 |
Protein | Solute carrier family 12 member 1 |
Uniprot ID | Q13621 |
Function | Electrically silent transporter system. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume. |
Tissue Specificity | Kidney specific. |
Sub-cellular localization | Membrane; Multi-pass membrane protein. |
Sequence Similarities | |
Aliases | BSC1 antibody|Bumetanide sensitive sodium 3 antibody|Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2 antibody|Kidney specific Na K Cl symporter antibody|Kidney-specific Na-K-Cl symporter antibody|MGC48843 antibody|Na K 2Cl cotransporter antibody|NKCC2 antibody|potassiumchloride cotransporter 2 antibody|S12A1_HUMAN antibody|Slc12a1 antibody|sodium potassium chloride cotransporter 2 antibody|solute carrier family 12 (sodium/potassium/chloride transporters) antibody|Solute carrier family 12 member 1 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- SLC12A1 antibody, ASA-B1702, Western blotting
All lanes: Anti SLC12A1 (ASA-B1702) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: JURKAT Whole Cell Lysate at 40ug
Lane 3: SKOV Whole Cell Lysate at 40ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Predicted bind size: 121KD
Observed bind size: 121KD
Anti- SLC12A1 antibody, ASA-B1702, IHC(P)
IHC(P): Mouse Kidney Tissue
Anti- SLC12A1 antibody, ASA-B1702, IHC(P)
IHC(P): Rat Kidney Tissue