Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| protein tyrosine phosphatase, non-receptor type 11 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences. | ||||||
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | PTPN11 |
Protein | Tyrosine-protein phosphatase non-receptor type 11 |
Uniprot ID | Q06124 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | phosphatase 2 antibody|Protein tyrosine phosphatase 2C antibody|Protein Tyrosine Phosphatase Non receptor Type 11 antibody|Protein-tyrosine phosphatase 1D antibody|Protein-tyrosine phosphatase 2C antibody|PTN11_HUMAN antibody|PTP 1D antibody|PTP 2C antibody|PTP-1D antibody|PTP-2C antibody|PTP1D antibody|PTP2C antibody|PTPN 11 antibody|PTPN11 antibody|PTPN11 antibody|SAP2 antibody|SH PTP2 antibody|SH PTP3 antibody|SH-PTP2 antibody|SH-PTP3 antibody|SH2 domain containing protein tyrosine phosphatase 2 antibody|SHIP2 antibody|SHP 2 antibody|SHP-2 antibody|Shp2 antibody|SHPTP 2 antibody|SHPTP2 antibody|SHPTP3 antibody|SIT protein precursor antibody| Syp antibody|Tyrosine protein phosphatase non receptor type 11 antibody|Tyrosine-protein phosphatase non-receptor type 11 antibody |


