RUNX1/AML1  Antibody View larger

RUNX1/AML1 Antibody

ASA-B1638

$386.90

More info

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

runt-related transcription factor 1 Polyclonal IgG Rabbit Human, Mouse, Rat IHC-P, WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human RUNX1(200-233aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

RUNX1

Protein

Runt-related transcription factor 1

Uniprot ID

Q01196

Function

CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits KAT6B- dependent transcriptional activation. Controls the anergy and suppressive function of regulatory T-cells (Treg) by associating with FOXP3. Activates the expression of IL2 and IFNG and down- regulates the expression of TNFRSF18, IL2RA and CTLA4, in conventional T-cells (PubMed:17377532).

Tissue Specificity

Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.

Sub-cellular localization

Nucleus.

Sequence Similarities

Contains 1 Runt domain.

Aliases

Acute myeloid leukemia 1 antibody|Acute myeloid leukemia 1 protein antibody|alpha subunit antibody|alpha subunit core binding factor antibody|AML 1 antibody|AML1 antibody|AML1 EVI 1 antibody|AML1 EVI 1 fusion protein antibody|Aml1 oncogene antibody|AMLCR 1 antibody|AMLCR1 antibody|CBF alpha 2 antibody|CBF-alpha-2 antibody|CBFA 2 antibody|CBFA2 antibody|Core binding factor alpha 2 subunit antibody|Core binding factor runt domain alpha subunit 2 antibody|Core-binding factor subunit alpha-2 antibody|EVI 1 antibody|EVI1 antibody|Oncogene AML 1 antibody|Oncogene AML-1 antibody|OTTHUMP00000108696 antibody|OTTHUMP00000108697 antibody|OTTHUMP00000108699 antibodyOTTHUMP00000108700 antibody|OTTHUMP00000108702 antibody|PEA2 alpha B antibody|PEA2-alpha B antibody|PEBP2 alpha B antibody|PEBP2-alpha B antibody|PEBP2A2 antibody|PEBP2aB antibody|Polyomavirus enhancer binding protein 2 alpha B subunit antibody|Polyomavirus enhancer-binding protein 2 alpha B subunit antibody|Run1 antibody|Runt related transcription factor 1 antibody|Runt-related transcription factor 1 antibody|RUNX 1 antibody|Runx1 antibody|RUNX1_HUMAN antibody|SL3 3 enhancer factor 1 alpha B subunit antibody|SL3-3 enhancer factor 1 alpha B subunit antibody|SL3/AKV core binding factor alpha B subunit antibody|SL3/AKV core-binding factor alpha B subunit antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml HumanAssaySolutio's ECL kit
Immunohistochemistry(Paraffin-embedded Section) 0.5-1μg/ml Human, Mouse, RatAssaySolutio's IHC/ICC Detection kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti-RUNX1/AML1 antibody , ASA-B1638--1.jpg
All lanes: Anti RUNX1 (ASA-B1638) at 0.5ug/ml
WB: Recombinant Human RUNX1 Protein 0.5ng
Predicted bind size: 50KD
Observed bind size: 50KD
Anti-RUNX1/AML1 antibody , ASA-B1638--2.jpg
IHC(P): Rat Thymus Tissue
Anti-RUNX1/AML1 antibody , ASA-B1638--3.jpg
IHC(P): Human Mammary Cancer Tissue

© 2024 Novateinbio.com