More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| X-ray repair complementing defective repair in Chinese hamster cells 6 | Polyclonal | IgG | Rabbit | Human | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD), different from the related mouse sequence by one amino acid. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | XRCC6 |
Protein | X-ray repair cross-complementing protein 6 |
Uniprot ID | P12956 |
Function | Single-stranded DNA-dependent ATP-dependent helicase. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by XRCC6. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. The XRCC5/6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5/6 dimer is probably involved in stabilizing broken DNA ends and bringing them together. The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. Required for osteocalcin gene expression. Probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose- 5-phosphate at an abasic site near double-strand breaks. 5'-dRP lyase activity allows to 'clea' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5/6 dimer together with APEX1 acts as a negative regulator of transcription. |
Tissue Specificity | |
Sub-cellular localization | Nucleus. |
Sequence Similarities | Belongs to the ku70 family. |
Aliases | 5''-deoxyribose-5-phosphate lyase Ku70 antibody|5''-dRP lyase Ku70 antibody| 70 kDa subunit of Ku antigen antibody|ATP dependent DNA helicase 2 subunit 1 antibody|ATP dependent DNA helicase II 70 kDa subunit antibody|ATP-dependent DNA helicase 2 subunit 1 antibody|ATP-dependent DNA helicase II 70 kDa subunit antibody|CTC box binding factor 75 kDa subunit antibody|CTC box-binding factor 75 kDa subunit antibody|CTC75 antibody|CTCBF antibody| DNA repair protein XRCC6 antibody|G22P1 antibody|Ku 70 antibody|Ku autoantigen 70kDa antibody| Ku autoantigen p70 subunit antibody|Ku autoantigen, 70kDa antibody|Ku p70 antibody|Ku70 antibody|Ku70 DNA binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa antibody|Kup70 antibody|Lupus Ku autoantigen protein p70 antibody|ML8 antibody|Thyroid autoantigen 70kD (Ku antigen) antibody| Thyroid autoantigen antibody| Thyroid lupus autoantigen antibody| Thyroid lupus autoantigen p70 antibody|Thyroid-lupus autoantigen antibody|TLAA antibody|X ray repair complementing defective repair in Chinese hamster cells 6 antibody|X-ray repair complementing defective repair in Chinese hamster cells 6 antibody|X-ray repair cross-complementing protein 6 antibody|XRCC 6 antibody|XRCC6 antibody|XRCC6_HUMAN antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- Ku70 antibody, ASA-B1135, Western blotting
All lanes: Anti (ASA-B1135) at 0.5ug/ml
Lane 1: A549 Whole Cell Lysate at 40ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: HEPG2 Whole Cell Lysate at 40ug
Lane 4: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 70KD
Observed bind size: 70KD
All lanes: Anti (ASA-B1135) at 0.5ug/ml
Lane 1: A549 Whole Cell Lysate at 40ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: HEPG2 Whole Cell Lysate at 40ug
Lane 4: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 70KD
Observed bind size: 70KD
Anti- Ku70 antibody, ASA-B1135, IHC(P)
IHC(P): Human Tonsil Tissue
IHC(P): Human Tonsil Tissue
