More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| isocitrate dehydrogenase 1 (NADP+), soluble | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | IDH1 |
Protein | Isocitrate dehydrogenase [NADP] cytoplasmic |
Uniprot ID | O75874 |
Function | |
Tissue Specificity | |
Sub-cellular localization | Cytoplasm. |
Sequence Similarities | Belongs to the isocitrate and isopropylmalate dehydrogenases family. |
Aliases | Cytosolic NADP isocitrate dehydrogenase antibody|Cytosolic NADP-isocitrate dehydrogenase antibody|Epididymis luminal protein 216 antibody|Epididymis secretory protein Li 26 antibody|HEL-216 antibody|HEL-S-26 antibody|ICDH antibody|IDCD antibody|IDH antibody|IDH1 antibody|IDHC_HUMAN antibody|IDP antibody|IDPC antibody|Isocitrate dehydrogenase [NADP] cytoplasmic antibody|Isocitrate dehydrogenase 1 (NADP+) soluble antibody|NADP dependent isocitrate dehydrogenase cytosolic antibody|NADP dependent isocitrate dehydrogenase peroxisomal antibody|NADP(+)-specific ICDH antibody|Oxalosuccinate decarboxylase antibody|PICD antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- IDH1 antibody, ASA-B0966, Western blotting
All lanes: Anti IDH1 (ASA-B0966) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Rat Brain Tissue Lysate at 50ug
Lane 4: HELA Whole Cell Lysate at 40ug
Lane 5: SMMC Whole Cell Lysate at 40ug
Lane 6: A549 Whole Cell Lysate at 40ug
Lane 7: NIH3T3 Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 47KD
All lanes: Anti IDH1 (ASA-B0966) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Rat Brain Tissue Lysate at 50ug
Lane 4: HELA Whole Cell Lysate at 40ug
Lane 5: SMMC Whole Cell Lysate at 40ug
Lane 6: A549 Whole Cell Lysate at 40ug
Lane 7: NIH3T3 Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 47KD
Anti- IDH1 antibody, ASA-B0966, IHC(P)
IHC(P): Mouse Testis Tissue
IHC(P): Mouse Testis Tissue
Anti- IDH1 antibody, ASA-B0966, IHC(P)
IHC(P): Rat Testis Tissue
IHC(P): Rat Testis Tissue