Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| heat shock protein 90kDa alpha (cytosolic), class B member 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences. | ||||||
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | HSP90AB1 |
Protein | Heat shock protein HSP 90-beta |
Uniprot ID | P08238 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | 90 kda heat shock protein beta HSP90 beta antibody|D6S182 antibody|FLJ26984 antibody|Heat shock 84 kDa antibody|Heat shock 90kD protein 1, beta antibody|Heat shock 90kDa protein 1 beta antibody|Heat shock protein 90kDa alpha (cytosolic) class B member 1 antibody|Heat shock protein beta antibody|Heat shock protein HSP 90 beta antibody|Heat shock protein HSP 90-beta antibody|HS90B_HUMAN antibody|HSP 84 antibody|HSP 90 antibody|HSP 90 b antibody|HSP 90b antibody|HSP84 antibody|HSP90 BETA antibody|hsp90ab1 antibody|HSP90B antibody|HSPC2 antibody|HSPCB antibody |


