ASA-B0920
Warning: Last items in stock!
Availability date:
Hsp70 Antibody
Recipient :
* Required fields
or Cancel
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
heat shock 70kDa protein 1A | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | HSPA1A |
Protein | Heat shock 70 kDa protein 1A/1B |
Uniprot ID | P0DMV8 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | DAQB 147D11.1 001 antibody|FLJ54303 antibody|FLJ54370 antibody|FLJ54392 antibody|FLJ54408 antibody|FLJ75127 antibody|Heat shock 70 kDa protein 1 antibody|Heat shock 70 kDa protein 1/2 antibody|Heat shock 70 kDa protein 1A/1B antibody|heat shock 70kDa protein 1A antibody|Heat shock 70kDa protein 1B antibody|Heat shock induced protein antibody|heat shock protein 70 antibody|HSP70 1 antibody| HSP70 2 antibody|HSP70-1/HSP70-2 antibody|HSP70-1A antibody| HSP70.1 antibody|HSP70.1/HSP70.2 antibody|HSP70I antibody|HSP71_HUMAN antibody|HSP72 antibody|HSPA1 antibody|HSPA1A antibody|HSPA1B antibody|XXbac BCX40G17.3 001 antibody |