More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha (703-732aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | HIF1A |
Protein | Hypoxia-inducible factor 1-alpha |
Uniprot ID | Q16665 |
Function | Functions as a master transcriptional regulator of the adaptive response to hypoxia. Under hypoxic conditions, activates the transcription of over 40 genes, including erythropoietin, glucose transporters, glycolytic enzymes, vascular endothelial growth factor, HILPDA, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. Plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Activation requires recruitment of transcriptional coactivators such as CREBPB and EP300. Activity is enhanced by interaction with both, NCOA1 or NCOA2. Interaction with redox regulatory protein APEX seems to activate CTAD and potentiates activation by NCOA1 and CREBBP. Involved in the axonal distribution and transport of mitochondria in neurons during hypoxia. |
Tissue Specificity | Expressed in most tissues with highest levels in kidney and heart. Overexpressed in the majority of common human cancers and their metastases, due to the presence of intratumoral hypoxia and as a result of mutations in genes encoding oncoproteins and tumor suppressors. A higher level expression seen in pituitary tumors as compared to the pituitary gland. |
Sub-cellular localization | Cytoplasm. Nucleus. Nucleus speckle. |
Sequence Similarities | Contains 1 bHLH (basic helix-loop-helix) domain. |
Aliases | ARNT interacting protein antibody|ARNT-interacting protein antibody|Basic helix loop helix PAS protein MOP1 antibody|Basic-helix-loop-helix-PAS protein MOP1 antibody|bHLHe78 antibody|Class E basic helix-loop-helix protein 78 antibody|HIF 1A antibody|HIF 1alpha antibody|HIF-1-alpha antibody|HIF1 A antibody|HIF1 Alpha antibody|HIF1 antibody|HIF1-alpha antibody|HIF1A antibody|HIF1A_HUMAN antibody|Hypoxia inducible factor 1 alpha antibody|Hypoxia inducible factor 1 alpha isoform I.3 antibody|Hypoxia inducible factor 1 alpha subunit antibody|Hypoxia inducible factor 1 alpha subunit basic helix loop helix transcription factor antibody|Hypoxia inducible factor 1, alpha subunit (basic helix loop helix transcription factor) antibody|Hypoxia inducible factor1alpha antibody|Hypoxia-inducible factor 1-alpha antibody|Member of PAS protein 1 antibody|Member of PAS superfamily 1 antibody|Member of the PAS Superfamily 1 antibody|MOP 1 antibody|MOP1 antibody|PAS domain-containing protein 8 antibody|PASD 8 antibody|PASD8 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- HIF 1 alpha antibody, ASA-B0863, Western blotting
All lanes: Anti HIF 1 alpha (ASA-B0863) at 0.5ug/ml
WB: Recombinant Human HIF 1 alpha Protein 0.5ng
Predicted bind size: 36KD
Observed bind size: 36KD
All lanes: Anti HIF 1 alpha (ASA-B0863) at 0.5ug/ml
WB: Recombinant Human HIF 1 alpha Protein 0.5ng
Predicted bind size: 36KD
Observed bind size: 36KD
Anti- HIF 1 alpha antibody, ASA-B0863, Western blotting
All lanes: Anti HIF 1 alpha (ASA-B0863) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: SHG Whole Cell Lysate at 40ug
Lane 3: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 93KD
Observed bind size: 120KD
All lanes: Anti HIF 1 alpha (ASA-B0863) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: SHG Whole Cell Lysate at 40ug
Lane 3: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 93KD
Observed bind size: 120KD
Anti- HIF 1 alpha antibody, ASA-B0863,IHC(P)
IHC(P): Mouse Intestine Tissue
IHC(P): Mouse Intestine Tissue