More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| haptoglobin | Polyclonal | IgG | Rabbit | Human, Mouse | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence in the middle region of human Haptoglobin(128-160aa NNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | HP |
Protein | Haptoglobin |
Uniprot ID | P00738 |
Function | As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway. |
Tissue Specificity | Expressed by the liver and secreted in plasma. |
Sub-cellular localization | Secreted. |
Sequence Similarities | Belongs to the peptidase S1 family. |
Aliases | Binding peptide antibody|Bp antibody|Haptoglobin alpha chain antibody|Haptoglobin alpha(1S) beta antibody|Haptoglobin alpha(2FS) beta antibody|Haptoglobin beta chain antibody|Haptoglobin, alpha polypeptide antibody|Haptoglobin, beta polypeptide antibody|HP antibody|Hp2 alpha antibody|HP2 ALPHA2 antibody|HP2ALPHA2 antibody|HPA1S antibody|HPT antibody|HPT_HUMAN antibody|MGC111141 antibody|Zonulin antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- Haptoglobin antibody, ASA-B0836, Western blotting
All lanes: Anti Haptoglobin (ASA-B0836) at 0.5ug/ml
WB: Recombinant Human Haptoglobin Protein 0.5ng
Predicted bind size: 38KD
Observed bind size: 38KD
All lanes: Anti Haptoglobin (ASA-B0836) at 0.5ug/ml
WB: Recombinant Human Haptoglobin Protein 0.5ng
Predicted bind size: 38KD
Observed bind size: 38KD
Anti- Haptoglobin antibody, ASA-B0836, Western blotting
All lanes: Anti Haptoglobin (ASA-B0836) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: SMMC Whole Cell Lysate at 40ug
Lane 3: HEPA Whole Cell Lysate at 40ug
Lane 4: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 45KD
Observed bind size: 45KD
All lanes: Anti Haptoglobin (ASA-B0836) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: SMMC Whole Cell Lysate at 40ug
Lane 3: HEPA Whole Cell Lysate at 40ug
Lane 4: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 45KD
Observed bind size: 45KD
Anti- Haptoglobin antibody, ASA-B0836, IHC(P)
IHC(P): Human Placenta Tissue
IHC(P): Human Placenta Tissue