ASA-B0824
Warning: Last items in stock!
Availability date:
Grp75 Antibody
Recipient :
* Required fields
or Cancel
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
heat shock 70kDa protein 9 (mortalin) | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | HSPA9 |
Protein | Stress-70 protein, mitochondrial |
Uniprot ID | P38646 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | 75 kDa glucose regulated protein antibody|75 kDa glucose-regulated protein antibody|CSA antibody|Glucose Regulated Protein antibody|Grp 75 antibody|GRP-75 antibody|GRP75 antibody|GRP75_HUMAN antibody|Heat shock 70 kDa protein 9 antibody|Heat shock 70kD protein 9 antibody|heat shock 70kDa protein 9 antibody|Heat shock 70kDa protein 9B antibody|Heat shock protein 74 kDa A antibody|Heat shock protein A antibody|Heat shock protein cognate 74 antibody|Hsc74 antibody|Hsp74 antibody|Hsp74a antibody|HSPA9 antibody|Hspa9a antibody| HSPA9B antibody|MGC4500 antibody|mitochondrial antibody|Mortalin 2 antibody|Mortalin antibody|Mortalin perinuclear antibody| Mortalin2 antibody|MOT 2 antibody|MOT antibody|MOT2 antibody|Mthsp70 antibody|p66 mortalin antibody|P66 MOT antibody|PBP74 antibody| Peptide binding protein 74 antibody|Peptide-binding protein 74 antibody|Stress 70 protein mitochondrial antibody|Stress 70 protein mitochondrial precursor antibody|Stress-70 protein antibody |