More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| glutathione peroxidase 4 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human GPX4(30-60aa ASRDDWRCARSMHEFSAKDIDGHMVNLDKYR), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | GPX4 |
Protein | Phospholipid hydroperoxide glutathione peroxidase, mitochondrial |
Uniprot ID | P36969 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | Glutathione peroxidase 4 antibody|GPX 4 antibody|GPX-4 antibody|GPX4 antibody|GPX4_HUMAN antibody|GSHPx-4 antibody|MCSP antibody| mitochondrial antibody|PHGPx antibody|Phospholipid hydroperoxidase antibody|Phospholipid hydroperoxide glutathione peroxidase antibody|Phospholipid hydroperoxide glutathione peroxidase mitochondrial antibody|snGPx antibody|snPHGPx antibody|Sperm nucleus glutathione peroxidase antibody |
Application Details
Anti- GPX4 antibody, ASA-B0809, Western blotting
All lanes: Anti GPX4 (ASA-B0809) at 0.5ug/ml
Lane 1: Rat Testis Tissue Lysate at 50ug
Lane 2: Mouse Testis Tissue Lysate at 50ug
Predicted bind size: 22KD
Observed bind size: 22KD
All lanes: Anti GPX4 (ASA-B0809) at 0.5ug/ml
Lane 1: Rat Testis Tissue Lysate at 50ug
Lane 2: Mouse Testis Tissue Lysate at 50ug
Predicted bind size: 22KD
Observed bind size: 22KD
Anti- GPX4 antibody, ASA-B0809, IHC(P)
IHC(P): Mouse Testis Tissue
IHC(P): Mouse Testis Tissue
Anti- GPX4 antibody, ASA-B0809, IHC(P)
IHC(P): Rat Testis Tissue
IHC(P): Rat Testis Tissue