More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| fatty acid binding protein 4, adipocyte | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related mouse and rat sequences. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | FABP4 |
Protein | Fatty acid-binding protein, adipocyte |
Uniprot ID | P15090 |
Function | Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus (By similarity). |
Tissue Specificity | |
Sub-cellular localization | Cytoplasm. Nucleus. Note: Depending on the nature of the ligand, a conformation change exposes a nuclear localization motif and the protein is transported into the nucleus. Subject to constitutive nuclear export (By similarity). |
Sequence Similarities | |
Aliases | 3T3-L1 lipid-binding protein antibody|422/aP2 antibody|A FABP antibody|A-FABP antibody|adipocyte antibody|Adipocyte lipid binding protein antibody| Adipocyte lipid-binding protein antibody|Adipocyte protein AP2 antibody|Adipocyte-type fatty acid-binding protein antibody|AFABP antibody|ALBP antibody| ALBP/Ap2 antibody|aP2 antibody|FABP antibody|FABP4 antibody|FABP4_HUMAN antibody|Fatty acid binding protein 4 adipocyte antibody|Fatty acid binding protein 4 antibody|Fatty acid binding protein adipocyte antibody|Fatty acid-binding protein 4 antibody|Fatty acid-binding protein antibody|Lbpl antibody|Myelin P2 protein homolog antibody|P15 antibody|P2 adipocyte protein antibody|Protein 422 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Mouse, Rat Human | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Mouse, Rat Human | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- FABP4 antibody, ASA-B0675, Western blotting
All lanes: Anti FABP4 (ASA-B0675) at 0.5ug/ml
Lane 1: Rat Thymus Tissue Lysate at 50ug
Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 3: Mouse Thymus Tissue Lysate at 50ug
Lane 4: Mouse Cardiac Muscle Tissue Lysate at 50ug
Predicted bind size: 15KD
Observed bind size: 15KD
All lanes: Anti FABP4 (ASA-B0675) at 0.5ug/ml
Lane 1: Rat Thymus Tissue Lysate at 50ug
Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 3: Mouse Thymus Tissue Lysate at 50ug
Lane 4: Mouse Cardiac Muscle Tissue Lysate at 50ug
Predicted bind size: 15KD
Observed bind size: 15KD
Anti- FABP4 antibody, ASA-B0675, IHC(P)
IHC(P): Mouse Intestine Tissue
IHC(P): Mouse Intestine Tissue
Anti- FABP4 antibody, ASA-B0675, IHC(P)
IHC(P): Rat Intestine Tissue
IHC(P): Rat Intestine Tissue