More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| EWS RNA-binding protein 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | EWSR1 |
Protein | RNA-binding protein EWS |
Uniprot ID | Q01844 |
Function | Might normally function as a transcriptionnal repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
Tissue Specificity | Ubiquitous. |
Sub-cellular localization | Nucleus. |
Sequence Similarities | Belongs to the RRM TET family. |
Aliases | bK984G1.4 antibody|bK984G1.4 Ewing sarcoma breakpoint region 1 protein antibody|Ewing sarcoma breakpoint region 1 antibody|Ewing sarcoma breakpoint region 1 protein antibody|Ewings sarcoma EWS Fli1 type 1 oncogene antibody|EWS antibody|EWS oncogene antibody|EWS RNA binding protein 1 antibody|EWS_HUMAN antibody|EWSR 1 antibody|Ewsr1 antibody|EWSR1 protein antibody|RNA binding protein EWS antibody|RNA-binding protein EWS antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- EWSR1 antibody, ASA-B0674, Western blotting
All lanes: Anti EWSR1 (ASA-B0674) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Testis Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: SKOV Whole Cell Lysate at 40ug
Lane 5: SW620 Whole Cell Lysate at 40ug
Predicted bind size: 68KD
Observed bind size: 95KD
All lanes: Anti EWSR1 (ASA-B0674) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Testis Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: SKOV Whole Cell Lysate at 40ug
Lane 5: SW620 Whole Cell Lysate at 40ug
Predicted bind size: 68KD
Observed bind size: 95KD
Anti- EWSR1 antibody, ASA-B0674, IHC(P)
IHC(P): Mouse Testis Tissue
IHC(P): Mouse Testis Tissue
Anti- EWSR1 antibody, ASA-B0674, IHC(P)
IHC(P): Rat Testis Tissue
IHC(P): Rat Testis Tissue