More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| cytochrome P450, family 27, subfamily B, polypeptide 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR), different from the related mouse and rat sequences by six amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | CYP27B1 |
Protein | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial |
Uniprot ID | O15528 |
Function | Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D) to 1-alpha,25-dihydroxyvitamin D3 (1,25(OH)2D) plays an important role in normal bone growth, calcium metabolism, and tissue differentiation. |
Tissue Specificity | Kidney. |
Sub-cellular localization | Mitochondrion membrane. |
Sequence Similarities | Belongs to the cytochrome P450 family. |
Aliases | 1alpha(OH)ase antibody|25-hydroxyvitamin D(3) 1-alpha-hydroxylase antibody| 25-hydroxyvitamin D-1 alpha hydroxylase antibody|25-OHD-1 alpha-hydroxylase antibody|Calcidiol 1-monooxygenase antibody|CP27B_HUMAN antibody|CP2B antibody|CYP1 antibody|CYP1ALPHA antibody|CYP27B antibody|Cyp27b1 antibody|Cytochrome p450 27B1 antibody|Cytochrome p450 27B13 antibody|Cytochrome P450 family 27 subfamily B polypeptide 1 antibody|Cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1 antibody| Cytochrome P450 subfamily XXVIIB polypeptide 1 antibody|Cytochrome P450C1 alpha antibody| Cytochrome P450VD1-alpha antibody|mitochondrial antibody|P450C1 alpha antibody| P450c1 antibody|P450C1-alpha antibody|P450VD1-alpha antibody|PDDR antibody|VD3 1A hydroxylase antibody|VDD1 antibody|VDDR antibody|VDDR I antibody|VDDRI antibody|VDR antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Rat | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti-CYP27B1 antibody, ASA-B0548, Western blotting
All lanes: Anti CYP27B1 (ASA-B0548) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Mouse Kidney Tissue Lysate at 50ug
Lane 3: 293T Whole Cell Lysate at 40ug
Predicted bind size: 57KD
Observed bind size: 57KD
All lanes: Anti CYP27B1 (ASA-B0548) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Mouse Kidney Tissue Lysate at 50ug
Lane 3: 293T Whole Cell Lysate at 40ug
Predicted bind size: 57KD
Observed bind size: 57KD
Anti-CYP27B1 antibody, ASA-B0548, IHC(P)
IHC(P): Rat Kidney Tissue
IHC(P): Rat Kidney Tissue
Anti-CYP27B1 antibody, ASA-B0548, IHC(P)
IHC(P): Human Kidney Cancer Tissue
IHC(P): Human Kidney Cancer Tissue