More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| aquaporin 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | AQP1 |
Protein | Aquaporin-1 |
Uniprot ID | P29972 |
Function | Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. |
Tissue Specificity | Detected in erythrocytes (at protein level). Expressed in a number of tissues including erythrocytes, renal tubules, retinal pigment epithelium, heart, lung, skeletal muscle, kidney and pancreas. Weakly expressed in brain, placenta and liver. |
Sub-cellular localization | Cell membrane. |
Sequence Similarities | Belongs to the MIP/aquaporin (TC 1.A.8) family. |
Aliases | AQP 1 antibody|AQP CHIP antibody|AQP-1 antibody|AQP1 antibody| AQP1_ HUMAN antibody|Aquaporin CHIP antibody|Aquaporin-1 antibody|Aquaporin-CHIP antibody|Aquaporin1 antibody|Channel forming integral protein 28kDa antibody| Channel like integral membrane protein 28 kDa antibody|CHIP 28 antibody| CHIP28 antibody|CO antibody|Colton blood group antibody|Growth factor induced delayed early response protein antibody|MGC26324 antibody|Urine water channel antibody|Water channel protein CHIP 29 antibody|Water channel protein CHIP29 antibody|Water channel protein for red blood cells and kidney proximal tubule antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Mouse, Rat Human | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat Human | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- Aquaporin 1 antibody, ASA-B0133, Western blotting
All lanes: Anti Aquaporin 1 (ASA-B0133) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Rat Lung Tissue Lysate at 50ug
Lane 3: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 4: PC-12 Whole Cell Lysate at 40ug
Lane 5: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 29KD
Observed bind size: 29KD
All lanes: Anti Aquaporin 1 (ASA-B0133) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Rat Lung Tissue Lysate at 50ug
Lane 3: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 4: PC-12 Whole Cell Lysate at 40ug
Lane 5: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 29KD
Observed bind size: 29KD
Anti- Aquaporin 1 antibody, ASA-B0133, IHC(P)
IHC(P): Mouse Kidney Tissue
IHC(P): Mouse Kidney Tissue
Anti- Aquaporin 1 antibody, ASA-B0133, IHC(P)
IHC(P): Rat Kidney Tissue
IHC(P): Rat Kidney Tissue