APLP1  Antibody View larger

APLP1 Antibody

ASA-B0118

$386.90

More info

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

amyloid beta (A4) precursor-like protein 1PolyclonalIgGRabbitHuman, Mouse, RatIHC-P, WBImmunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1 (82-112aa RRCLRDPQRVLEYCRQMYPELQIARVEQATQ), different from the related mouse sequence by three amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

APLP1

Protein

Amyloid-like protein 1

Uniprot ID

P51693

Function

May play a role in postsynaptic function. The C-terminal gamma-secretase processed fragment, ALID1, activates transcription activation through APBB1 (Fe65) binding (By similarity). Couples to JIP signal transduction through C-terminal binding. May interact with cellular G-protein signaling pathways. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I.

Tissue Specificity

Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD).

Sub-cellular localization

Cell membrane; Single-pass type I membrane protein.

Sequence Similarities

 

Aliases

AMYLOID BETA A4 PRECURSOR-LIKE PROTEIN 1 antibody|AMYLOID PRECURSOR-LIKE PROTEIN antibody| Amyloid-like protein 1 precursor antibody|APLP 1 antibody|APLP antibody|APLP-1 antibody| Aplp1 antibody| APLP1_HUMAN antibody|C30 antibody

Application Details

ApplicationConcentration*SpeciesValidated Using**
Western blot0.1-0.5μg/mlHuman, RatAssaySolutio's ECL kit
Immunohistochemistry(Paraffin-embedded Section)0.5-1μg/mlMouse, Rat HumanAssaySolutio's IHC/ICC Detection kit


AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- APLP1
Anti- APLP1 antibody, ASA-B0118, Western blotting
All lanes: Anti APLP1 (ASA-B0118) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Testis Tissue Lysate at 50ug
Lane 3: SGC Whole Cell Lysate at 40ug
Lane 4: 22RV1 Whole Cell Lysate at 40ug
Lane 5: MCF-7 Whole Cell Lysate at 40ug
Predicted band size: 72KD
Observed band size: 85KD
 
Anti- APLP1m
Anti- APLP1 antibody, ASA-B0118,IHC(P)
Mouse Brain Tissue
 
Anti- APLP1r
Anti- APLP1 antibody, ASA-B0118,IHC(P)
Rat Brain Tissue
 

© 2024 Novateinbio.com