More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| amyloid beta (A4) precursor-like protein 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1 (82-112aa RRCLRDPQRVLEYCRQMYPELQIARVEQATQ), different from the related mouse sequence by three amino acids. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | APLP1 |
Protein | Amyloid-like protein 1 |
Uniprot ID | P51693 |
Function | May play a role in postsynaptic function. The C-terminal gamma-secretase processed fragment, ALID1, activates transcription activation through APBB1 (Fe65) binding (By similarity). Couples to JIP signal transduction through C-terminal binding. May interact with cellular G-protein signaling pathways. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I. |
Tissue Specificity | Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD). |
Sub-cellular localization | Cell membrane; Single-pass type I membrane protein. |
Sequence Similarities | |
Aliases | AMYLOID BETA A4 PRECURSOR-LIKE PROTEIN 1 antibody|AMYLOID PRECURSOR-LIKE PROTEIN antibody| Amyloid-like protein 1 precursor antibody|APLP 1 antibody|APLP antibody|APLP-1 antibody| Aplp1 antibody| APLP1_HUMAN antibody|C30 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Mouse, Rat Human | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- APLP1 antibody, ASA-B0118, Western blotting
All lanes: Anti APLP1 (ASA-B0118) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Testis Tissue Lysate at 50ug
Lane 3: SGC Whole Cell Lysate at 40ug
Lane 4: 22RV1 Whole Cell Lysate at 40ug
Lane 5: MCF-7 Whole Cell Lysate at 40ug
Predicted band size: 72KD
Observed band size: 85KD
Anti- APLP1 antibody, ASA-B0118,IHC(P)
Mouse Brain Tissue
Anti- APLP1 antibody, ASA-B0118,IHC(P)
Rat Brain Tissue