ASA-B0056
Warning: Last items in stock!
Availability date:
AIF Antibody
Recipient :
* Required fields
or Cancel
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
apoptosis-inducing factor, mitochondrion-associated, 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, ICC, WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | AIFM1 |
Protein | Apoptosis-inducing factor 1, mitochondrial |
Uniprot ID | O95831 |
Function | Functions both as NADH oxidoreductase and as regulator of apoptosis. In response to apoptotic stimuli, it is released from the mitochondrion intermembrane space into the cytosol and to the nucleus, where it functions as a proapoptotic factor in a caspase-independent pathway. In contrast, functions as an antiapoptotic factor in normal mitochondria via its NADH oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i.e. caspase-independent fragmentation of chromosomal DNA. Interacts with EIF3G,and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. Plays a critical role in caspase- independent, pyknotic cell death in hydrogen peroxide-exposed cells. Binds to DNA in a sequence-independent manner. |
Tissue Specificity | Detected in muscle and skin fibroblasts (at protein level). Isoform 5 is frequently down-regulated in human cancers. |
Sub-cellular localization | Mitochondrion intermembrane space. Mitochondrion inner membrane. Cytoplasm. Nucleus. Cytoplasm, perinuclear region. Note: Proteolytic cleavage during or just after translocation into the mitochondrial intermembrane space (IMS) results in the formation of an inner-membrane-anchored mature form (AIFmit). During apoptosis, further proteolytic processing leads to a mature form, which is confined to the mitochondrial IMS in a soluble form (AIFsol). AIFsol is released to the cytoplasm in response to specific death signals, and translocated to the nucleus, where it induces nuclear apoptosis. Colocalizes with EIF3G in the nucleus and perinuclear region. |
Sequence Similarities | Belongs to the FAD-dependent oxidoreductase family. |
Aliases | AIFM1 antibody|AIFM1_HUMAN antibody|Apoptosis inducing factor 1, mitochondrial antibody|Apoptosis inducing factor antibody|Apoptosis inducing factor, mitochondrion associated, 1 antibody|Apoptosis-inducing factor 1 antibody|CMTX4 antibody|COXPD6 antibody|Harlequin antibody|Hq antibody| mAIF antibody|MGC111425 antibody|MGC5706 antibody|mitochondrial antibody|Neuropathy, axonal motor-sensory, with deafness and mental retardation antibody|neuropathy, axonal, motor-sensory with deafness and mental retardation (Cowchock syndrome) antibody|PDCD 8 antibody|PDCD8 antibody|Programmed cell death 8 (apoptosis inducing factor) antibody| Programmed cell death 8 antibody|Programmed cell death 8 isoform 1 antibody|Programmed cell death 8 isoform 2 antibody|Programmed cell death 8 isoform 3 antibody|Programmed cell death protein 8 antibody|Programmed cell death protein 8 mitochondrial antibody|Programmed cell death protein 8 mitochondrial precursor antibody|Striatal apoptosis inducing factor antibody |
Application | Concentration* | Species | Validated Using** |
Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio's ECL kit |
Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio's IHC/ICC Detection kit |
Immunocytochemistry | 0.5-1μg/ml | Human | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P) and ICC. *Blocking peptide can be purchased at $65. Contact us for more information