More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| alpha-2-HS-glycoprotein | Polyclonal | IgG | Rabbit | Human, Rat | ELISA, IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human AHSG (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | AHSG |
Protein | Alpha-2-HS-glycoprotein |
Uniprot ID | P02765 |
Function | Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions. |
Tissue Specificity | Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins. |
Sub-cellular localization | Secreted. |
Sequence Similarities | Belongs to the fetuin family. |
Aliases | 59 kDa bone sialic acid-containing protein antibody|A2HS antibody|Aa2-066 antibody|AHS antibody|Ahsg alpha-2-HS-glycoprotein antibody| Ahsg antibody|Alpha 2 HS Glycoprotein antibody|Alpha 2 Z globulin antibody|Alpha-2-HS-glycoprotein antibody|Alpha-2-HS-glycoprotein chain B antibody|Alpha-2-Z-globulin antibody|Asialofetuin antibody|Ba alpha 2 glycoprotein antibody|Ba-alpha-2-glycoprotein antibody|BSP antibody| Countertrypin antibody|Fetua antibody|FETUA_HUMAN antibody|Fetuin, mouse, homolog of antibody|Fetuin A antibody|Fetuin-A antibody| Glycoprotein PP63 antibody|HSGA antibody|pp63 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human | AssaySolutio's IHC/ICC Detection kit |
| ELISA | 0.1-0.5μg/ml | Human | Sandwich ELISA format |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- AHSG antibody, ASA-B0054, Western blotting
All lanes: Anti AHSG (ASA-B0054) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Predicted band size: 39KD
Observed band size: 39KD
All lanes: Anti AHSG (ASA-B0054) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Predicted band size: 39KD
Observed band size: 39KD
Anti- AHSG antibody, ASA-B0054, IHC(P)
Human Liver Cancer Tissue
Human Liver Cancer Tissue