Warning: Last items in stock!
Availability date:
Transforming Growth Factor-Beta 1 Human Recombinant, GST Tag ( TGF b 1 Human, GST )
DescriptionThe TGF-b 1 (177-391 a.a.) is purified by standard chromatographic techniques and shows a 51 kDa band on SDS-PAGE (including GST tag).SourceEscherichia Coli.Physical AppearanceSterile Filtered solution at a concentration of 0.1Recipient :
* Required fields
or Cancel
Formulation | The protein solution (500ug/ml) contains 50mM Tris-HCl, pH-7.5 and 10mM L-glutathione (reduced). |
Purity | Greater than 80.0% as determined by SDS-PAGE. |
Description | The Recombinant Human TGF-b1 (aa 309-390) is purified by standard chromatographic techniques and shows a 35kDa band on SDS-PAGE (including GST tag). |
Protein Background | Transforming growth factor betas (TGF Betas) mediate many cell-cell interactions that occur during embryonic development. Three TGF Betas have been identified in mammals. TGF Beta 1, TGF Beta 2 and TGF Beta 3 are each synthesized as precursor proteins that are very similar in that each is cleaved to yield a 112 amino acid polypeptide that remains associated with the latent portion of the molecule. |
Expression host | Escherichia Coli. |
Synonyms | Transforming growth factor beta-1, TGF-beta-1, CED, DPD1, TGFB. |
Reagent Appearance | Sterile Filtered solution. |
Stability | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
Amino acid sequence | KWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS. |