View larger
Hepatitis B Surface Antigen, preS2 Recombinant ( HBsAg preS2 )
DescriptionThe E.coli derivedRecombinant Hepatitis B Surface Antigen preS2 is a single non-glycosylated polypeptide chain containing 55 amino acids & having a molecular weight of5.7 kDa.Purification MethodHBsAg protein was purified by proprietary
Data sheet
| Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
| Formulation | HBsAg protein was lyophilized from 0.2m filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl. |
| Solubility | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at |
| Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Description | The Recombinant Hepatitis B Surface Antigen preS2 is approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids. Purified by proprietary chromatographic technique. |
| Protein Background | Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, MHBs has a 55 amino acid region called preS2. |
| Expression host | E.coli. |
| Amino acid sequence | MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN. |
| Purification Method | HBsAg protein was purified by proprietary chromatographic technique. |