View larger

Recombinant Human Papillomavirus 18 ( HPV 18 )

DescriptionThe Recombinant HPV-18 (a 56kDa antigen) comprised from the E2, E6 & E7 epitopes is expressed in E. coli and fused to a GST-Tag, having a total Mw of 83kDa, purified by standard chromatography.SourceE.ColiPurification MethodThe

$303.00

Data sheet

Formulation Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.
Purity Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Description The Recombinant HPV-18 is a full length large capsid protein having a Mw of 56kDa expressed in E. coli and fused to a GST-Tag, having a total Mw of 83kDa, purified by standard chromatography.
Protein Background Human papillomavirus family consist of over 200 types. Over than 30 to 40 types of HPV are transferred via sexual contact and infect the anogenital region initiating genital warts. Persistent infection with "high-risk" HPV types results in skin warts and leads to precancerous lesions and invasive cancer. HPV infection is considered as a source for all incidents of cervical cancer. E2, E6, and E7 proteins of HPV-16 and 18 are considered the main viral oncoproteins that take part in cervical cancer. The type-specific antigen epitopes of E2, E6, and E7 proteins of HPV-16 are fused together and expressed in E. coli for diagnostic purpose.
Expression host E.Coli
Synonyms Papillomavirus, HPV, Papilloma Virus.
Amino acid sequence VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA.
Purification Method The recombinant HPV-16 fusion protein was purified by GSH affinity chromatography technique.
Physical Appearence Sterile filtered clear liquid formulation.

© 2024 Novateinbio.com