View larger

Recombinant Human Papillomavirus 6 ( HPV 6 )

DescrptionRecombinant HPV6 antigen is a 55.6kDa protein covering the full length of HPV6 major capsid, its N-terminus is fused with a GST tag, having a total Mw of 81.6kDa. The HPV6 was Purified by proprietary chromatographic

$315.00

Data sheet

Formulation PBS and 3M Urea.
Purity Protein is >95% pure as determined by 10% PAGE (coomassie staining).
Applications Each laboratory should determine an optimum working titer for use in its particular application.
Protein Background Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV-6 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV-6 large capsid is used as a potential candidate for vaccine development.
Expression host E.Coli.
Synonyms Papillomavirus, HPV, Papilloma Virus.
Stability Recombinant HPV-6 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Amino acid sequence VDVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVKRPAVSKASAAPKRKRAK.
Physical Appearence Sterile filtered clear liquid formulation.

© 2024 Novateinbio.com