View larger
Interleukin-1 beta Rat Recombinant ( IL 1 beta Rat )
DescriptionInterleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 152 amino acids and having a molecular mass of 17.3 kDa. The IL-1b is purified by proprietary chromatographic
Data sheet
| Reconstitution | In PBS, pH 7.4 and 0.1 % NaN3. |
| Formulation | The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4. |
| Solubility | It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions. |
| Purity | Greater than 97.0% as determined by SDS-PAGE. |
| Description | Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.The IL-1b is purified by proprietary chromatographic techniques. |
| Protein Background | Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
| Expression host | Escherichia Coli. |
| Synonyms | Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta. |
| Reagent Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Stability | Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Amino acid sequence | MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS. |
| Biological Activity | The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg. |
| Titer | Antibody is shipped as in liquid form with ice packs. |