View larger
Interleukin-19 Mouse Recombinant ( IL 19 Mouse )
DescriptionInterleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 152 amino acids and having a molecular mass of 17722 Dalton. The IL-19 is purified by proprietary chromatographic
Data sheet
| Formulation | Lyophilized from a sterile filtered aqueous solution containing 5mM Na3PO4 and 150mM NaCl, pH 7.5. |
| Solubility | It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions. |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Description | Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques. |
| Protein Background | IL19 is a cytokine that belongs to the IL10 cytokine subfamily. IL-19 is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described. |
| Expression host | Escherichia Coli. |
| Synonyms | Interleukin-19, IL-19, Il19. |
| Reagent Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Stability | Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Amino acid sequence | MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA. |