View larger

Interleukin-6 Recombinant Human, CHO ( IL 6 Human, CHO )

DescriptionInterleukin-6 Human Recombinant produced in CHO is a single, glycosylated polypeptide chain containing 185 amino acids and migrates at 22 kDa as a glycosilated protein on SDS-PAGE.The IL6 is purified by proprietary chromatographic

$201.00

Data sheet

Formulation IL-6 is a sterile filtered (0.22um) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2.
Purity Greater than 95.0% as determined by analysis by SDS-PAGE.
Description Interleukin-6 Human Recombinant produced in CHO is a 21-23kDa single, glycosylated polypeptide chain containing 183 amino acids.
Protein Background IL-6 is a cytokine with a wide variety of biological functions: it plays an essential role in the final differentiation of b-cells into ig-secreting cells, it induces myeloma and plasmacytoma growth, it induces nerve cells differentiation, in hepatocytes it induces acute phase reactants.
Expression host Chinese Hamster Ovarian Cells.
Synonyms IFN-b2, B cell differentiation factor, BCDF, BSF-2, HPGF, HSF, MGI-2, B-cell stimulatory factor 2, Interferon beta-2, Hybridoma growth factor, CTL differentiation factor, CDF, IL-6, HGF.
Reagent Appearance Sterile filtered colorless solution.
Stability Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Amino acid sequence VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Biological Activity ED50

© 2024 Novateinbio.com