Warning: Last items in stock!
Availability date:
Spleen Tyrosine Kinase Human Recombinant ( SYK Human )
DescriptionSYK Human Recombinant full length protein (1-635 aa) produced in HEK 293 cells with an N-terminal His-Flag tag, having a molecular weight of 74.25kDa.Human SYK is purified by proprietary chromatographic techniques.SourceHEK 293Recipient :
* Required fields
or Cancel
Formulation | SYK protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol. |
Purity | Greater than 85.0% as determined by SDS-PAGE. |
Description | SYK Human Recombinant full length protein (1-635 aa) produced in HEK 293 cells with an N-terminal His-Flag tag, having a molecular weight of 74.25kDa.Human SYK is purified by proprietary chromatographic techniques. |
Protein Background | Spleen Tyrosine Kinase (SYK) belongs to the family of non-receptor type Tyr protein kinases. The SYK protein is extensively expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events which mediate diverse cellular responses, including proliferation, differentiation, and phagocytosis. SYK is considered to be a modulator of epithelial cell growth and a likely tumor suppressor in human breast carcinomas. SYK is a positive effector of BCR-stimulated responses. SYK connects the B-cell antigen receptor (BCR) to the utilization of calcium ion either through a phosphoinositide 3-kinase-dependent pathway, when not phosphorylated on tyrosines of the linker region, or through a phospholipase C-gamma-dependent pathway, when phosphorylated on Tyr-348 and Tyr-352. Therefore the differential phosphorylation of Syk can define the pathway by which BCR is coupled to the regulation of intracellular calcium ion (By similarity). SYK also phosphorylates USP25 and regulates its intracellular levels. |
Expression host | HEK 293 cells. |
Synonyms | Tyrosine-protein kinase SYK, Spleen tyrosine kinase, p72-Syk, SYK. |
Reagent Appearance | Sterile filtered colorless solution. |
Stability | Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles. |
Amino acid sequence | MHHHHHHDYKDDDDKKLMASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGL YLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQES DGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQL EKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKV LHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFG GRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELA PWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTV KKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAES WMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARN VLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVW SFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWT YDVENRPGFAAVELRLRNYYYDVVN. |